Iright
BRAND / VENDOR: Proteintech

Proteintech, 18896-1-AP, B-Myb Polyclonal antibody

CATALOG NUMBER: 18896-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The B-Myb (18896-1-AP) by Proteintech is a Polyclonal antibody targeting B-Myb in WB, IP, IHC, ELISA applications with reactivity to human samples 18896-1-AP targets B-Myb in WB, IHC, IF, IP, ChIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information MYBL2, also named as BMYB, is a 700 amino acid protein, which is phosphorylated by cyclin A/CDK2 during S-phase. MYBL2 is a transcription factor involved in the regulation of cell survival, proliferation, and differentiation. The calculated molecular weight of MYBL2 is 79 kDa, but modified MYBL2 is about 90 kDa (PMID: 11418655). Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13525 Product name: Recombinant human MYBL2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 401-700 aa of BC007585 Sequence: SGIGTPPSVLKRQRKRRVALSPVTENSTSLSFLDSCNSLTPKSTPVKTLPFSPSQFLNFWNKQDTLELESPSLTSTPVCSQKVVVTTPLHRDKTPLHQKHAAFVTPDQKYSMDNTPHTPTPFKNALEKYGPLKPLPQTPHLEEDLKEVLRSEAGIELIIEDDIRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDVKLMMSTLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMSSAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS Predict reactive species Full Name: v-myb myeloblastosis viral oncogene homolog (avian)-like 2 Calculated Molecular Weight: 79 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC007585 Gene Symbol: B Myb Gene ID (NCBI): 4605 RRID: AB_10644283 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10244 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924