Iright
BRAND / VENDOR: Proteintech

Proteintech, 18930-1-AP, CLEC4D Polyclonal antibody

CATALOG NUMBER: 18930-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CLEC4D (18930-1-AP) by Proteintech is a Polyclonal antibody targeting CLEC4D in WB, IHC, ELISA applications with reactivity to human samples 18930-1-AP targets CLEC4D in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Human peripheral blood leukocyte cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6852 Product name: Recombinant human CLEC4D protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 40-215 aa of BC032313 Sequence: LVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN Predict reactive species Full Name: C-type lectin domain family 4, member D Calculated Molecular Weight: 215 aa, 25 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC032313 Gene Symbol: CLEC4D Gene ID (NCBI): 338339 RRID: AB_2878568 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8WXI8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924