Iright
BRAND / VENDOR: Proteintech

Proteintech, 19027-1-AP, SNTB2 Polyclonal antibody

CATALOG NUMBER: 19027-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SNTB2 (19027-1-AP) by Proteintech is a Polyclonal antibody targeting SNTB2 in WB, ELISA applications with reactivity to human, mouse, rat samples 19027-1-AP targets SNTB2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse pancreas tissue, rat pancreas tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Background Information Syntrophin beta 2(SNTB2) also known as SNT3 and SNTL, belongs to the syntrophin family. SNTB2 is a peripheral membrane protein associated with dystrophin and antimyotrophin-associated protein complexes. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13504 Product name: Recombinant human SNTB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-300 aa of BC048215 Sequence: MRVAAATAAAGAGPAMAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAAELEPALGPAAAAFNGLPNGGGAGDSLPGSPSRGLGPPSPPAPPRGPAGEAGASPPVRRVRVVKQEAGGLGISIKGGRENRMPILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIREVTPYIKKPSLVSDLPWEGAAPQSPSFSGSEDSGSPKHQNSTKDRKIIPLKMCFAARNLSMPDLENRLIELHSPDSRNTLILRCKDTATAHSWFVAIHTNIM Predict reactive species Full Name: syntrophin, beta 2 (dystrophin-associated protein A1, 59kDa, basic component 2) Calculated Molecular Weight: 540 aa, 58 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC048215 Gene Symbol: SNTB2 Gene ID (NCBI): 6645 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13425 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924