Iright
BRAND / VENDOR: Proteintech

Proteintech, 19140-1-AP, VPS11 Polyclonal antibody

CATALOG NUMBER: 19140-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The VPS11 (19140-1-AP) by Proteintech is a Polyclonal antibody targeting VPS11 in WB, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 19140-1-AP targets VPS11 in WB, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, human brain tissue, mouse pancreas tissue, mouse brain tissue, human kidney tissue, human heart tissue, HeLa cells, K-562 cells, rat brain tissue Positive IP detected in: HEK-293 cells Positive FC (Intra) detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Vesicle-mediated protein sorting plays an important role in segregating intracellular molecules into distinct organelles. In yeast, Vps proteins are involved in the trafficking of endocytic and biosynthetic proteins to the vacuole, which functionally resembles the lysosome of higher organisms. VPS11 is the human homolog of the yeast class C Vps11 protein, a subunit of the HOPS (homotypic fusion and protein transport) complex. Mammalian Vps11 may play a role in vesicle-mediated protein trafficking to lysosomal compartments and membrane docking/fusion reactions of late endosomes/lysosomes. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6227 Product name: Recombinant human VPS11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 689-941 aa of BC065563 Sequence: FQQIMHYHMQHEQYRQVISVCERHGEQDPSLWEQALSYFARKEEDCKEYVAAVLKHIENKNLMPPLLVVQTLAHNSTATLSVIRDYLVQKLQKQSQQIAQDELRVRRYREETTRIRQEIQELKASPKIFQKTKCSICNSALELPSVHFLCGHSFHQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLRCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLTSSLEAGLQRDLLMHSRRGT Predict reactive species Full Name: vacuolar protein sorting 11 homolog (S. cerevisiae) Calculated Molecular Weight: 108 kDa Observed Molecular Weight: 108-112 kDa GenBank Accession Number: BC065563 Gene Symbol: VPS11 Gene ID (NCBI): 55823 RRID: AB_10642572 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H270 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924