Proteintech, 19157-1-AP, Tie-2/CD202b Polyclonal antibody

Size: 20ul / 150ul The Tie-2/CD202b (19157-1-AP) by Proteintech is a Polyclonal antibody targeting Tie-2/CD202b in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 19157-1-AP targets Tie-2/CD202b in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, mouse liver tissue, Rat lung tissue Positive IP detected in: mouse lung tissue Positive IHC detected in: human placenta tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Background Information Tie2 (also known as TEK) is a tyrosine-protein kinase expressed almost exclusively on endothelial cells. It contains two immunoglobulin-like domains, three epidermal growth factor (EGF)--like domains and three fibronectin type III repeats. Tie2 acts as a cell-surface receptor for ANGPT1, ANGPT2, and ANGPT4 and regulates angiogenesis, endothelial cell survival, proliferation, migration, adhesion and cell spreading, reorganization of the actin cytoskeleton, but also maintenance of vascular quiescence. Mutations in the gene Tie2 are associated with inherited venous malformations of the skin and mucous membranes. Human Tie2 has a calculated molecular weight of 126 kDa. As a result of glycosylation, the apparent molecular mass of Tie2 is approximately 140-160 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13523 Product name: Recombinant human TEK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 779-1124 aa of BC035514 Sequence: RRMAQAFQNVREEPAVQFNSGTLALNRKVKNNPDPTIYPVLDWNDIKFQDVIGEGNFGQVLKARIKKDGLRMDAAIKRMKEYASKDDHRDFAGELEVLCKLGHHPNIINLLGACEHRGYLYLAIEYAPHGNLLDFLRKSRVLETDPAFAIANSTASTLSSHHLLHFAADVARGMDYLSQKQFIHRDLAARNILVGENYVAKIADFGLSRGQEVYVKKTMGRLPVRWMAIESLNYSVYTTNSDVWSYGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRLEKPLNCDDEVYDLMRQCWREKPYERPSFAQILVSLNRMLEERKTYVNTTLYEKFTYAGIDCSAEEAA Predict reactive species Full Name: TEK tyrosine kinase, endothelial Calculated Molecular Weight: 1124 aa, 126 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC035514 Gene Symbol: Tie2 Gene ID (NCBI): 7010 RRID: AB_10644297 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q02763 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.