Proteintech, 19254-1-AP, COSMC Polyclonal antibody

Size: 20ul / 150ul The COSMC (19254-1-AP) by Proteintech is a Polyclonal antibody targeting COSMC in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 19254-1-AP targets COSMC in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Caco-2 cells Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information COSMC (C1GALT1C1) is a molecular chaperone required for expression of active T-synthase (CIGALT1) which catalyzes the synthesis of Tn antigen. Tn antigens are cancer-associated glycans and play an important role in tumor progression. Dysfunctional COSMC is able to convert a wild type protein into a tumor-specific antigen affecting tumor cell biology. COSMC overexpression had been observed in various cancers. COSMC mutations have been observed in an autoimmune disease Tn syndrome. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6899 Product name: Recombinant human C1GALT1C1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-318 aa of BC050441 Sequence: MLSESSSFLKGVMLGSIFCALITMLGHIRIGHGNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKRLNSLLNIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHIFNDALVFLPPNGSDND Predict reactive species Full Name: C1GALT1-specific chaperone 1 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 36-37 kDa GenBank Accession Number: BC050441 Gene Symbol: COSMC Gene ID (NCBI): 29071 RRID: AB_10638003 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96EU7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.