Proteintech, 19272-1-AP, TNFR2/CD120b Polyclonal antibody

Size: 20ul / 150ul The TNFR2/CD120b (19272-1-AP) by Proteintech is a Polyclonal antibody targeting TNFR2/CD120b in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 19272-1-AP targets TNFR2/CD120b in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: NK-92 cells, Jurkat cells, HEK-293 cells, THP-1 cells, mouse thymus tissue, rat thymus tissue Positive IP detected in: HEK-293 cells Positive IHC detected in: human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Tumor necrosis factor-alpha (TNFA/TNFSF2) is a multifunctional cytokine that plays a key role in regulating inflammation, immune functions, host defense, and apoptosis (PMID: 16407280). TNFA signals through two distinct cell surface receptors, TNFR1 (TNFRSF1A, CD120a, p55) and TNFR2 (TNFRSF1B, CD120b, p75). TNFR1 is widely expressed, whereas TNFR2 exhibits more restricted expression, being found on CD4 and CD8 T lymphocytes, endothelial cells, microglia, oligodendrocytes, neuron subtypes, cardiac myocytes, thymocytes and human mesenchymal stem cells (PMID: 20489699; 22374304). In contrast to TNFR1, TNFR2 does not have a death domain. TNFR2 only signals for antiapoptotic reactions. However, recent evidence indicates that TNFR2 also signals to induce TRAF2 degradation (PMID: 22374304). Various defects in the TNFR2 pathway, due to polymorphisms in the TNFR2 gene, upregulated expression of TNFR2 and TNFR2 shedding, have been implicated in the pathology of several autoimmune disorders (PMID: 20489699). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5866 Product name: Recombinant human TNFR2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 38-282 aa of BC052977 Sequence: STCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAEGSTGDFALPVGLIVGVTALGLLIIGVVNCV Predict reactive species Full Name: tumor necrosis factor receptor superfamily, member 1B Calculated Molecular Weight: 48 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC052977 Gene Symbol: TNFR2 Gene ID (NCBI): 7133 RRID: AB_10640674 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P20333 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.