Proteintech, 19274-1-AP, TAF5L Polyclonal antibody

Size: 20ul / 150ul The TAF5L (19274-1-AP) by Proteintech is a Polyclonal antibody targeting TAF5L in WB, IHC, ELISA applications with reactivity to human samples 19274-1-AP targets TAF5L in WB, IHC, CoIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Jurkat cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5942 Product name: Recombinant human TAF5L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-325 aa of BC041094 Sequence: MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV Predict reactive species Full Name: TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor, 65kDa Calculated Molecular Weight: 66 kDa Observed Molecular Weight: 66 kDa GenBank Accession Number: BC041094 Gene Symbol: TAF5L Gene ID (NCBI): 27097 RRID: AB_10642700 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75529 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.