Iright
BRAND / VENDOR: Proteintech

Proteintech, 19344-1-AP, Gastrokine 1 Polyclonal antibody

CATALOG NUMBER: 19344-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Gastrokine 1 (19344-1-AP) by Proteintech is a Polyclonal antibody targeting Gastrokine 1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 19344-1-AP targets Gastrokine 1 in WB, IF, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human stomach tissue, mouse stomach tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Gastrokine 1 (GKN1), a stomach-specific protein also known as 18 kDa antrum mucosa protein (AMP-18) or foveolin, belongs to the gastrokine family of gastric mucus cell-secreted proteins. The human GKN1 gene has been localized in a region of chromosome 2p13 of about 6 kb and contains 6 exons. GKN1 is expressed only in normal human stomach, but is absent from gastric adenocarcinomas, gastro-esophageal adenocarcinoma cell lines, and other normal and tumor gastro-intestinal tissues. GKN1may play an important role in normal gastric function and may be a gastric tumour suppressor. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6091 Product name: Recombinant human GKN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 35-196 aa of BC059778 Sequence: NVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN Predict reactive species Full Name: gastrokine 1 Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 20-22 kDa GenBank Accession Number: BC059778 Gene Symbol: Gastrokine 1 Gene ID (NCBI): 56287 RRID: AB_10837226 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NS71 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924