Iright
BRAND / VENDOR: Proteintech

Proteintech, 19446-1-AP, ALDH3B1 Polyclonal antibody

CATALOG NUMBER: 19446-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ALDH3B1 (19446-1-AP) by Proteintech is a Polyclonal antibody targeting ALDH3B1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 19446-1-AP targets ALDH3B1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: RAW 264.7 cells, J774A.1 cells, rat liver tissue Positive IHC detected in: human lung cancer tissue, human renal cell carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information ALDH3B1(Aldehyde dehydrogenase family 3 member B1) is also named as ALDH7 and belongs to the aldehyde dehydrogenase family. It catalyzes fatty and aromatic aldehydes. ALDH3B1 may play a role in the detoxification of aldehydes produced during oxidative stress. This protein has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7025 Product name: Recombinant human ALDH3B1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-230 aa of BC002553 Sequence: MDPLGDTLRRLREAFHAGRTRPAEFRAAQLQGLGRFLQENKQLLHDALAQDLHKSAFESEVSEVAISQGEVTLALRNLRAWMKDERVPKNLATQLDSAFIRKEPFGLVLIIAPWNYPLNLTLVPLVGALAAGNCVVLKPSEISKNVEKILAEVLPQYVDQSCFAVVLGGPQETGQLLEHRFDYIFFTGSPRVGKIVMTAAAKHPSKQRLPPPSWVFPLPASASSLSRSQP Predict reactive species Full Name: aldehyde dehydrogenase 3 family, member B1 Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC002553 Gene Symbol: ALDH3B1 Gene ID (NCBI): 221 RRID: AB_2861362 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43353 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924