Iright
BRAND / VENDOR: Proteintech

Proteintech, 19809-1-AP, RTCB-Specific Polyclonal antibody

CATALOG NUMBER: 19809-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The RTCB-Specific (19809-1-AP) by Proteintech is a Polyclonal antibody targeting RTCB-Specific in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 19809-1-AP targets RTCB-Specific in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue, Jurkat cells Positive IP detected in: HeLa cells Positive IHC detected in: human lung cancer tissue, human liver cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: A431 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information RTCB (also known as HSPC117, C22orf28, FAAP, and D10Wsu52e) is a essential subunit of the tRNA ligase complex, which is localized in both the cytoplasm and nucleus, and is involved in RNA repair and stress-induced splicing. As a multifunctional protein, RTCB also serves as a cell adhesion protein and plays an important role in embryo and placenta development. Recently, RTCB has been identified as an UPR RNA ligase that catalyzes unconventional XBP1 mRNA splicing. This antibody specifically recognizes endogenous RTCB protein. (25087875) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13836 Product name: Recombinant human C22orf28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 159-505 aa of BC000151 Sequence: GVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQADPNKVSARAKKRGLPQLGTLGAGNHYAEIQVVDEIFNEYAAKKMGIDHKGQVCVMIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARIASPEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDFDLHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMTETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHDAGISKKAIKLRPIAVIKG Predict reactive species Full Name: chromosome 22 open reading frame 28 Calculated Molecular Weight: 55 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC000151 Gene Symbol: RTCB Gene ID (NCBI): 51493 RRID: AB_10695047 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y3I0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924