Proteintech, 19845-1-AP, SP140L Polyclonal antibody

Size: 20ul / 150ul The SP140L (19845-1-AP) by Proteintech is a Polyclonal antibody targeting SP140L in WB, IP, ELISA applications with reactivity to human samples 19845-1-AP targets SP140L in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IP detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13894 Product name: Recombinant human SP140L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC004921 Sequence: MFEDSEDSCRNLVPVQRVVYNVLSELEKTFNLSVLEALFSEVNMQEYPDLIHIYKSFKNAIQDKLSFQESDRKEREERPDIKLSLKQGEVPESPEARKESDQACGKMDTVDIANNSTLGKPKRKRSKNK Predict reactive species Full Name: SP140 nuclear body protein-like Calculated Molecular Weight: 438 aa, 50 kDa Observed Molecular Weight: 67-77 kDa GenBank Accession Number: BC004921 Gene Symbol: SP140L Gene ID (NCBI): 93349 RRID: AB_2878613 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H930 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.