Iright
BRAND / VENDOR: Proteintech

Proteintech, 19850-1-AP, Thymosin beta 4 Polyclonal antibody

CATALOG NUMBER: 19850-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The Thymosin beta 4 (19850-1-AP) by Proteintech is a Polyclonal antibody targeting Thymosin beta 4 in IHC, IF-P, IP, ELISA applications with reactivity to human, mouse, rat samples 19850-1-AP targets Thymosin beta 4 in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IP detected in: mouse skeletal muscle tissue Positive IHC detected in: mouse skeletal muscle tissue, mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:400-1:1600 Background Information Thymosin beta 4 (Tβ4), encoded by TMSB4X gene, is an actin sequestering protein which plays an important role in the organization of the cytoskeleton. Numerous studies have demonstrated the effects of Tβ4 on cell migration, proliferation, apoptosis and inflammation after exogenous treatment (PMID: 22652458). Recently, novel findings provided compelling evidence that Tβ4 played a key role in facilitating tumor metastasis and angiogenesis. It has been found that Tβ4 expressed increasingly in a number of metastatic tumors, thus providing a potential target of opportunity for cancer management, especially for cancer metastasis therapy (PMID: 22856429). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13914 Product name: Recombinant human TMSB4X protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-63 aa of BC001631 Sequence: AQTRLRSYSCASLRFSSATMSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES Predict reactive species Full Name: thymosin beta 4, X-linked Calculated Molecular Weight: 63 aa, 7 kDa Observed Molecular Weight: 5 kDa GenBank Accession Number: BC001631 Gene Symbol: Thymosin beta 4 Gene ID (NCBI): 7114 RRID: AB_10642437 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62328 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924