Proteintech, 19889-1-AP, COX4NB Polyclonal antibody

Size: 20ul / 150ul The COX4NB (19889-1-AP) by Proteintech is a Polyclonal antibody targeting COX4NB in WB, ELISA applications with reactivity to human, mouse, rat samples 19889-1-AP targets COX4NB in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, COLO 320 cells, human placenta tissue, mouse liver tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13720 Product name: Recombinant human COX4NB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC001472 Sequence: MPGVKLTTQAYCKMVLHGAKYPHCAVNGLLVAEKQKPRKEHLPLGGPGAHHTLFVDCIPLFHGTLALAPMLEVALTLIDSWCKDHSYVIAGYYQANERVKDASPNQVAEKVASRIAEGFSDTALIMVDNTKFTMDCVAPTIHVYEHHENRWRCRDPHHDYCEDWPEAQRISASLLDSRSYETLVDFDNHLDDIRNDWTNPEINKAVLHLC Predict reactive species Full Name: COX4 neighbor Calculated Molecular Weight: 210 aa, 24 kDa Observed Molecular Weight: 24 kDa GenBank Accession Number: BC001472 Gene Symbol: COX4NB Gene ID (NCBI): 10328 RRID: AB_2878618 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43402 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.