Iright
BRAND / VENDOR: Proteintech

Proteintech, 19896-1-AP, GHRH Polyclonal antibody

CATALOG NUMBER: 19896-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GHRH (19896-1-AP) by Proteintech is a Polyclonal antibody targeting GHRH in IHC, ELISA applications with reactivity to human samples 19896-1-AP targets GHRH in IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human colon cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information GHRH, also known as GHRF, belongs to the glucagon family. GHRH is a hypothalamic peptide that stimulates synthesis and proliferation of pituitary somatotroph cells as well as secretion of growth hormone. GHRH expression is predominantly in the human hypothalamus, with some expression in the basal ganglia (PMID: 39913072). Defects in GHRH are a cause of dwarfism, while hypersecretion of GHRH is a cause of gigantism. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13787 Product name: Recombinant human GHRH protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 21-108 aa of BC098161 Sequence: PPPPLTLRMRRYADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARLGRQVDSMWAEQKQMELESILVALLQKHRNSQG Predict reactive species Full Name: growth hormone releasing hormone Calculated Molecular Weight: 108 aa, 12 kDa GenBank Accession Number: BC098161 Gene Symbol: GHRH Gene ID (NCBI): 2691 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P01286 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924