Proteintech, 19911-1-AP, CHCHD7 Polyclonal antibody

Size: 20ul / 150ul The CHCHD7 (19911-1-AP) by Proteintech is a Polyclonal antibody targeting CHCHD7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 19911-1-AP targets CHCHD7 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, human placenta tissue, rat pancreas tissue Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13735 Product name: Recombinant human CHCHD7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC002546 Sequence: MHQTRTGKKTVRMPSVTQRLRDPDINPCLSESDASTRCLDENNYDRERCSTYFLRYKNCRRFWNSIVMQRRKNGVKPFMPTAAERDEILRAVGNMPY Predict reactive species Full Name: coiled-coil-helix-coiled-coil-helix domain containing 7 Calculated Molecular Weight: 97 aa, 12 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC002546 Gene Symbol: CHCHD7 Gene ID (NCBI): 79145 RRID: AB_10666734 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BUK0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.