Proteintech, 19919-1-AP, TMEM38B Polyclonal antibody

Size: 20ul / 150ul The TMEM38B (19919-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM38B in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 19919-1-AP targets TMEM38B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells Positive IHC detected in: mouse testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information TMEM38B encodes endoplasmic reticulum membrane monovalent cation-specific channel which is involved in the release of calcium (Ca2+) from intracellular stores. TMEM38B, also known as TRIC-B, is one of the two trimeric intracellular cation (TRIC) channels. TRIC-B deficiency causes bone disease due to defective Ca2+ release and signaling in the bone cells. (PMID: 34036147, PMID: 39385871) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13835 Product name: Recombinant human TMEM38B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 162-291 aa of BC000049 Sequence: ERLVKGDWKPEGDEWLKMSYPAKVTLLGSVIFTFQHTQHLAISKHNLMFLYTIFIVATKITMMTTQTSTMTFAPFEDTLSWMLFGWQQPFSSCEKKSEAKSPSNGVGSLASKPVDVASDNVKKKHTKKNE Predict reactive species Full Name: transmembrane protein 38B Calculated Molecular Weight: 291 aa, 33 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC000049 Gene Symbol: TMEM38B Gene ID (NCBI): 55151 RRID: AB_2878623 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NVV0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.