Proteintech, 19924-1-AP, METTL16 Polyclonal antibody

Size: 20ul / 150ul The METTL16 (19924-1-AP) by Proteintech is a Polyclonal antibody targeting METTL16 in WB, IHC, ELISA applications with reactivity to human, rat, mouse samples 19924-1-AP targets METTL16 in WB, IHC, IF, ELISA applications and shows reactivity with human, rat, mouse samples. Tested Applications Positive WB detected in: HeLa cells, rat testis tissue, NCI-H1299 cells, NIH/3T3 cells, mouse testis tissue Positive IHC detected in: human colon tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Methyltransferase-like protein 16 (METTL16) is a human RNA methyltransferase that installs m6A marks on U6 small nuclear RNA (U6 snRNA) and S-adenosylmethionine (SAM) synthetase pre-mRNA. METTL16 is considered a protective gene, suppressing the development of OC, HCC, and endocrine system tumors (PMID: 33237039, PMID: 33133142, PMID: 34187307). However, the high expression of METTL16 has been linked with a poor survival rate in patients with breast cancer (PMID: 33362863). METTL16 has 2 isoforms with molecular weights of 64 and 26 kDa. Specification Tested Reactivity: human, rat, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13889 Product name: Recombinant human METT10D protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-213 aa of BC001213 Sequence: MALSKSMHARNRYKDKPPDFAYLASKYPDFKQHVQINLNGRVSLNFKDPEAVRALTCTLLREDFGLSIDIPLERLIPTVPLRLNYIHWVEDLIGHQDSDKSTLRRGIDIGTGASCIYPLLGATLNGWYFLATEVDDMCFNYAKKNVEQNNLSDLIKVVKVPQKTLLMDALKEESEIIYDFCMCNPPFFANQLEAKGVNSRNPRRPPPSSVNTG Predict reactive species Full Name: methyltransferase 10 domain containing Calculated Molecular Weight: 562 aa, 64 kDa Observed Molecular Weight: 70-75 kDa GenBank Accession Number: BC001213 Gene Symbol: METTL16 Gene ID (NCBI): 79066 RRID: AB_10639364 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q86W50 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.