Proteintech, 19931-1-AP, CALHM2 Polyclonal antibody

Size: 20ul / 150ul The CALHM2 (19931-1-AP) by Proteintech is a Polyclonal antibody targeting CALHM2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 19931-1-AP targets CALHM2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CALHM2, also named as FAM26B, is a pore-forming subunit of a voltage-gated ion channel. It's a critical ATP-releasing channel that modulates neural activity and as a potential risk factor of depression. There're three isoforms of CALHM2 with calculated MW 36 kDa, 24 kDa and 22 kDa. It's about 32-36 kDa in western blot with membrane protein extraceted lysate. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13909 Product name: Recombinant human CALHM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 206-323 aa of BC000039 Sequence: KHYCSPLSYRQEAYWAQYRANEDQLFQRTAEVHSRVLAANNVRRFFGFVALNKDDEELIANFPVEGTQPRPQWNAITGVYLYRENQGLPLYSRLHKWAQGLAGNGAAPDNVEMALLPS Predict reactive species Full Name: calcium homeostasis modulator 2 Calculated Molecular Weight: 323 aa, 36 kDa Observed Molecular Weight: 32-36 kDa GenBank Accession Number: BC000039 Gene Symbol: CALHM2 Gene ID (NCBI): 51063 RRID: AB_2878626 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HA72 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.