Proteintech, 20105-1-AP, RNF5 Polyclonal antibody

Size: 20ul / 150ul The RNF5 (20105-1-AP) by Proteintech is a Polyclonal antibody targeting RNF5 in WB, ELISA applications with reactivity to human, mouse samples 20105-1-AP targets RNF5 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MDA-MB-231 cells, SH-SY5Y cells, mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information The RING (really interesting new gene) finger protein 5 (RNF5) is an ER-associated E3 ubiquitin ligase involved in ER-associated degradation (ERAD) for misfolded proteins. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13737 Product name: Recombinant human RNF5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-125 aa of BC004155 Sequence: MAAAEEEDGGPEGPNRERGGAGATFECNICLETAREAVVSVCGHLYCWPCLHQWLETRPERQECPVCKAGISREKVVPLYGRGSQKPQDPRLKTPPRPQGQRPAPESRGGFQPFGDTGGFHFSFG Predict reactive species Full Name: ring finger protein 5 Calculated Molecular Weight: 180 aa, 20 kDa Observed Molecular Weight: 15-50 kDa GenBank Accession Number: BC004155 Gene Symbol: RNF5 Gene ID (NCBI): 6048 RRID: AB_3669323 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99942 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.