Proteintech, 20114-1-AP, MGST3 Polyclonal antibody

Size: 20ul / 150ul The MGST3 (20114-1-AP) by Proteintech is a Polyclonal antibody targeting MGST3 in WB, ELISA applications with reactivity to human, mouse, rat samples 20114-1-AP targets MGST3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Microsomal glutathione transferase 3 (MGST3) is member of microsomal prostaglandin E synthases super family that exhibits diversified functions in eicosanoid and GSH metabolism. MGST3 expression level correlates with hippocampal size, and mutation of MGST3 contributes to spinal muscular dystrophy (PMID: 37760932). MGST3 KD did not alter intracellular reactive oxygen species level but selectively reduced the expression of apoptosis indicators which could be associated with the receptor of cysteinyl leukotrienes, the downstream metabolites of MGST3 in arachidonic acid pathway (PMID: 38971310). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13932 Product name: Recombinant human MGST3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-152 aa of BC000505 Sequence: MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSIALLGLVGTTVCSAFQHLGWVKSGLGSGPKCCH Predict reactive species Full Name: microsomal glutathione S-transferase 3 Calculated Molecular Weight: 152 aa, 17 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: BC000505 Gene Symbol: MGST3 Gene ID (NCBI): 4259 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O14880 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.