Proteintech, 20117-1-AP, TMCO6 Polyclonal antibody

Size: 20ul / 150ul The TMCO6 (20117-1-AP) by Proteintech is a Polyclonal antibody targeting TMCO6 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 20117-1-AP targets TMCO6 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: U-251 cells, human testis tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13992 Product name: Recombinant human TMCO6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 407-493 aa of BC001910 Sequence: NVAEKGPAYCQRLWPGPLLPALLHTLAFSDTEVVGQSLELLHLLFLYQPEAVQVFLQQSGLQALERHQEEAQLQDRVYALQQTALQG Predict reactive species Full Name: transmembrane and coiled-coil domains 6 Calculated Molecular Weight: 493 aa, 54 kDa Observed Molecular Weight: 45-50 kDa GenBank Accession Number: BC001910 Gene Symbol: TMCO6 Gene ID (NCBI): 55374 RRID: AB_10733118 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96DC7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.