Iright
BRAND / VENDOR: Proteintech

Proteintech, 20121-1-AP, APOBEC2 Polyclonal antibody

CATALOG NUMBER: 20121-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The APOBEC2 (20121-1-AP) by Proteintech is a Polyclonal antibody targeting APOBEC2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 20121-1-AP targets APOBEC2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, mouse skeletal muscle tissue, rat heart tissue, rat skeletal muscle tissue Positive IP detected in: mouse skeletal muscle tissue Positive IHC detected in: mouse heart tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information APOBEC2, also named as ARCD1 and ARP1, is a member of the activation-induced deaminase/apolipoprotein B mRNA editing enzyme catalytic polypeptide (APOBEC) cytidine deaminase family expressed in differentiated skeletal and cardiac muscle. APOBEC family members have diverse roles by their ability to edit DNA and/or RNA. Apobec2 is one of the oldest members of the APOBEC family, along with the lymphoid-specific activation-induced deaminase. Unlike other APOBEC family members, the enzymatic activity and substrate of Apobec2 have not been fully demonstrated, and its biologic functions remain unknown. It can be detected as 25-30 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13699 Product name: Recombinant human APOBEC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-224 aa of BC047767 Sequence: MAQKEEAAVATEAASQNGEDLENLDDPEKLKELIELPPFEIVTGERLPANFFKFQFRNVEYSSGRNKTFLCYVVEAQGKGGQVQASRGYLEDEHAAAHAEEAFFNTILPAFDPALRYNVTWYVSSSPCAACADRIIKTLSKTKNLRLLILVGRLFMWEEPEIQAALKKLKEAGCKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADILK Predict reactive species Full Name: apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 2 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 25-30 kDa GenBank Accession Number: BC047767 Gene Symbol: APOBEC2 Gene ID (NCBI): 10930 RRID: AB_10697687 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y235 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924