Iright
BRAND / VENDOR: Proteintech

Proteintech, 20125-1-AP, TMEM214 Polyclonal antibody

CATALOG NUMBER: 20125-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TMEM214 (20125-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM214 in WB, IF, ELISA applications with reactivity to human, mouse, rat samples 20125-1-AP targets TMEM214 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: C2C12 Positive IF detected in: human muscle slides Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF): IF : 1:25-1:100 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13884 Product name: Recombinant human TMEM214 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC002467 Sequence: GRRPGVGAGAGGRGGGRNRRALGEANGVWKYDLTPAIQTTSTLYERGFENIMKRQNKEQVPPPAVEPKKPGNKKQPKKVATPPNQNQKQGRFRSLEEALKALDVADLQKELDKSQSVFSGNPSIWLKDLASYLNYKLQAPLSEPTLSQHTHDYPYSLVSRELRGIIRGLLAKAAGSLELFFDHCLFTMLQELDKTPGESLHGYRICIQAILQDKPKIATANLGKFLELLRSHQSRPAKCLTIMWALGQAGFANLTEGLKVWLGIMLPVLGIKSLSPFAITYLDRLLLMHPNLTKGFGMIGPKDFFPLLDFAYMPNNSLTPSLQEQLCQLYPRLKMLAFGAKPDSTLHTYF Predict reactive species Full Name: transmembrane protein 214 Calculated Molecular Weight: 689 aa, 77 kDa Observed Molecular Weight: 77 kDa GenBank Accession Number: BC002467 Gene Symbol: TMEM214 Gene ID (NCBI): 54867 RRID: AB_2878642 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6NUQ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924