Proteintech, 20126-1-AP, C15orf39 Polyclonal antibody

Size: 20ul / 150ul The C15orf39 (20126-1-AP) by Proteintech is a Polyclonal antibody targeting C15orf39 in WB, ELISA applications with reactivity to human samples 20126-1-AP targets C15orf39 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells, A549 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13938 Product name: Recombinant human C15orf39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 928-1047 aa of BC001762 Sequence: FDTEAGAVSSSEPTVARDEPESLALAQKSPAPKVRKPGRKPPTPGPEKAEAAAGEESCGASPTPATSASPPGPTLKARFRSLLETAWLNGLALPTWGHKSSRPDQPSPCPQLLDSQSHHL Predict reactive species Full Name: chromosome 15 open reading frame 39 Calculated Molecular Weight: 1047 aa, 111 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC001762 Gene Symbol: C15orf39 Gene ID (NCBI): 56905 RRID: AB_2878643 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6ZRI6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.