Iright
BRAND / VENDOR: Proteintech

Proteintech, 20136-1-AP, ZHX2 Polyclonal antibody

CATALOG NUMBER: 20136-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZHX2 (20136-1-AP) by Proteintech is a Polyclonal antibody targeting ZHX2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 20136-1-AP targets ZHX2 in WB, IHC, IF/ICC, IP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, mouse brain tissue, mouse skeletal muscle tissue, mouse ovary tissue, mouse lung tissue, rat brain tissue, Jurkat cells Positive IP detected in: mouse brain tissue Positive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200 Background Information Zinc fingers and homeoboxes protein 2 is a protein that in humans is encoded by the ZHX2 gene. ZHX2 Act as a transcriptional repressor, represses the promoter activity of the CDC25C gene stimulated by NFYA (PMID:12741956). In addition to forming homodimers, this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14088 Product name: Recombinant human ZHX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 488-837 aa of BC042145 Sequence: SDHRYRCQRGIVHITSESLAKDQLAIAASRHGRTYHAYPDFAPQKFKEKTQGQVKILEDSFLKSSFPTQAELDRLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKKGQDVGAPNGALSRLDQLSGAQLTSSLPSPSPAIAKSQEQVHLLRSTFARTQWPTPQEYDQLAAKTGLVRTEIVRWFKENRCLLKTGTVKWMEQYQHQPMADDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSDRSEGSSRDGQGSDENEESSVVDYVEVTVGEEDAISDRSDSWSQAAAEGVSELAESDSDCVPAEAGQA Predict reactive species Full Name: zinc fingers and homeoboxes 2 Calculated Molecular Weight: 837 aa, 92 kDa Observed Molecular Weight: 92-100 kDa GenBank Accession Number: BC042145 Gene Symbol: ZHX2 Gene ID (NCBI): 22882 RRID: AB_10666438 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6X8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924