Iright
BRAND / VENDOR: Proteintech

Proteintech, 20157-1-AP, ZFHX3 Polyclonal antibody

CATALOG NUMBER: 20157-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ZFHX3 (20157-1-AP) by Proteintech is a Polyclonal antibody targeting ZFHX3 in IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 20157-1-AP targets ZFHX3 in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells, MCF-7 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:150-1:600 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Zinc finger homeobox protein 3 (ZFHX3) encodes a transcription factor which contains four homeodomains and seventeen zinc fingers. The ZFHX3 transcription factor appears to regulate myogenic and neuronal differentiation. Although the function of ZFHX3 in cardiac tissue is unknown, it is expressed in mouse hearts. (PMID: 26267381) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14080 Product name: Recombinant human ZFHX3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 921-1270 aa of BC029653 Sequence: QLVSEELMNLGESFIQTNDPSLKLFQCAVCNKFTTDNLDMLGLHMNVERSLSEDEWKAVMGDSYQCKLCRYNTQLKANFQLHCKTDKHVQKYQLVAHIKEGGKANEWRLKCVAIGNPVHLKCNACDYYTNSLEKLRLHTVNSRHEASLKLYKHLQQHESGVEGESCYYHCVLCNYSTKAKLNLIQHVRSMKHQRSESLRKLQRLQKGLPEEDEDLGQIFTIRRCPSTDPEEAIEDVEGPSETAADPEELAKDQEGGASSSQAEKELTDSPATSKRISFPGSSESPLSSKRPKTAEEIKPEQMYQCPYCKYSNADVNRLRVHAMTQHSVQPMLRCPLCQDMLNNKIHLQLH Predict reactive species Full Name: zinc finger homeobox 3 Calculated Molecular Weight: 3703 aa, 404 kDa GenBank Accession Number: BC029653 Gene Symbol: ZFHX3 Gene ID (NCBI): 463 RRID: AB_3669324 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15911 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924