Proteintech, 20158-1-AP, UBTD1 Polyclonal antibody

Size: 20ul / 150ul The UBTD1 (20158-1-AP) by Proteintech is a Polyclonal antibody targeting UBTD1 in WB, ELISA applications with reactivity to human, rat samples 20158-1-AP targets UBTD1 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: DU 145 cells, MG-63 cells, U2OS cells, rat skeletal muscle tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Ubiquitin domain-containing protein 1 (UBTD1) is highly evolutionary conserved and has been described to interact with E2 enzymes of the ubiquitin-proteasome system. Even if its biological functions remain largely unknown, UBTD1 expression is regulated by P53 and induces cellular senescence by stabilizing P53 through degradation of murine double minute 2 (MDM2).(PMID: 30804013,PMID: 33884955) Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14082 Product name: Recombinant human UBTD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 118-227 aa of BC007331 Sequence: YCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD Predict reactive species Full Name: ubiquitin domain containing 1 Calculated Molecular Weight: 227 aa, 26 kDa Observed Molecular Weight: 26-30 kDa GenBank Accession Number: BC007331 Gene Symbol: UBTD1 Gene ID (NCBI): 80019 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HAC8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.