Proteintech, 20164-1-AP, SMCR7L/MID51 Polyclonal antibody

Size: 20ul / 150ul The SMCR7L/MID51 (20164-1-AP) by Proteintech is a Polyclonal antibody targeting SMCR7L/MID51 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 20164-1-AP targets SMCR7L/MID51 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, mouse testis tissue, NIH/3T3 cells, RAW264.7, HEK-293T cells, HT-1080 cells Positive IP detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Human SMCR7L gene encodes, MID51, the mitochondrial dynamic protein of 51 kDa (also called mitochondrial elongation factor 1, MIEF1). MID51 is a single-pass membrane protein anchored to the mitochondrial outer membrane and regulates mitochondrial morphology. Mitochondrial morphology is controlled by two opposing processes: fusion and fission. Elevated MID51 levels induce extensive mitochondrial fusion, whereas depletion of MID51 causes mitochondrial fragmentation. MID51 interacts with and recruits Drp1 to mitochondria, suggesting a critical role of MID51 in regulation of mitochondrial fusion-fission machinery in vertebrates. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13775 Product name: Recombinant human SMCR7L protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-359 aa of BC002587 Sequence: FDTDTFCPPRPKPVARKGQVDLKKSRLRMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEVQYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQT Predict reactive species Full Name: Smith-Magenis syndrome chromosome region, candidate 7-like Calculated Molecular Weight: 463 aa, 51 kDa Observed Molecular Weight: 48-51 kDa GenBank Accession Number: BC002587 Gene Symbol: SMCR7L Gene ID (NCBI): 54471 RRID: AB_10639522 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NQG6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.