Iright
BRAND / VENDOR: Proteintech

Proteintech, 20168-1-AP, SLC25A23 Polyclonal antibody

CATALOG NUMBER: 20168-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC25A23 (20168-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A23 in WB, ELISA applications with reactivity to human, mouse, rat samples 20168-1-AP targets SLC25A23 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue, mouse skeletal muscle tissue, mouse testis tissue, SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SLC25A23 gene encodes a 468 amino acids polypeptide, named SCaMC-3, with a bipartite structure typical of calcium-binding mitochondrial solute carrier (CaMSC) proteins. The amino-terminal portion harbors three canonical EF-hand calcium-binding domains while the carboxyl-terminal portion of SCaMC-3 has the characteristic features of the mitochondrial solute carrier (MSC) superfamily. Northern blot analysis reveals the presence of the transcript in brain, heart, skeletal muscle, liver and small intestine. The SLC25A23 gene undergoes alternative splicing suggesting a modular nature of the encoded product. Three out of four putative protein isoforms lack a significant portion of the third mitochondrial carrier signature. The most common SCaMC-3 isoform shows a mitochondrial subcellular localization when transfected in HeLa cells and is able to bind calcium by Ca2+ dependent mobility shift assays.(PMID: 15716113) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13987 Product name: Recombinant human SLC25A23 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-189 aa of BC001656 Sequence: MRGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVLYFWKHSTLSSAGFSAWIKDSTAEQNRSKTTVLARR Predict reactive species Full Name: solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23 Calculated Molecular Weight: 468 aa, 52 kDa Observed Molecular Weight: 49-54 kDa GenBank Accession Number: BC001656 Gene Symbol: SLC25A23 Gene ID (NCBI): 79085 RRID: AB_10638608 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BV35 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924