Proteintech, 20191-1-AP, P2RY11 Polyclonal antibody

Size: 20ul / 150ul The P2RY11 (20191-1-AP) by Proteintech is a Polyclonal antibody targeting P2RY11 in WB, ELISA applications with reactivity to human samples 20191-1-AP targets P2RY11 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Nucleotides, the structural subunits of the nucleic acids, are also important extracellular signaling molecules. P2 receptors are a family of cell surface receptors that mediate a wide variety of physiologic effects in response to extracellular nucleotides. These receptors fall into two classes: P2X receptors, which are ligand-gated ion channels that mediate calcium and potassium fluxes in response to ATP, and P2Y receptors, which are G protein-coupled receptors (GPCRs). P2Y purinoceptor 11 (P2RY11) is a receptor for ATP and ADP coupled to G-proteins that activate both phosphatidylinositol-calcium and adenylyl cyclase second messenger systems. It is not activated by UTP or UDP (PMID: 9405388). Expression of P2RY11 has been detected in immune cells including dendritic cells, macrophages and non‐immune cells including cancer cells (PMID: 33463722). It is involved in immune regulation (PMID: 27246167). No murine P2ry11 has been identified. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14106 Product name: Recombinant human P2RY11 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 104-213 aa of BC009877 Sequence: HIMRVLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ Predict reactive species Full Name: purinergic receptor P2Y, G-protein coupled, 11 Calculated Molecular Weight: 374 aa, 40 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC009877 Gene Symbol: P2RY11 Gene ID (NCBI): 5032 RRID: AB_3669328 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96G91 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.