Iright
BRAND / VENDOR: Proteintech

Proteintech, 20288-1-AP, FUT2 Polyclonal antibody

CATALOG NUMBER: 20288-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The FUT2 (20288-1-AP) by Proteintech is a Polyclonal antibody targeting FUT2 in WB, ELISA applications with reactivity to human samples 20288-1-AP targets FUT2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, Calu-3 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Fucosyltransferase 2 (FUT2) is a key enzyme that catalyzes the transfer of fucose to the terminal galactose of type 1 or type 2 disaccharide via α1,2-linkage. FUT2 gene codes for the alpha(1,2)fucosyltransferase responsible for the synthesis of the H antigen, which is the precursor of the ABO histo-blood group antigens in body fluids and on the intestinal mucosa (PMID: 19487333). FUT2 is highly expressed in lung adenocarcinoma (LUAD) and plays a vital role in the tumorigenesis of LUAD (PMID: 36552800). FUT2 has a calculated molecular mass of ~39 kDa, and the 70kDa band might be the glycosylated form. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14047 Product name: Recombinant human FUT2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 29-153 aa of BC001899 Sequence: QRLAKIQAMWELPVQIPVLASTSKALGPSQLRGMWTINAIGRLGNQMGEYATLYALAKMNGRPAFIPAQMHSTLAPIFRITLPVLHSATASRIPWQNYHLNDWMEEEYRHIPGEYVRFTGYPCS Predict reactive species Full Name: fucosyltransferase 2 (secretor status included) Calculated Molecular Weight: 343 aa, 39 kDa Observed Molecular Weight: 35-39 kDa GenBank Accession Number: BC001899 Gene Symbol: FUT2 Gene ID (NCBI): 2524 RRID: AB_3669331 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q10981 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924