Proteintech, 20292-1-AP, MLN64 Polyclonal antibody

Size: 20ul / 150ul The MLN64 (20292-1-AP) by Proteintech is a Polyclonal antibody targeting MLN64 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 20292-1-AP targets MLN64 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF7 cells, mouse placenta tissue, MCF-7 cells, A549 cells, Jurkat cells, mouse brain tissue, rat brain tissue Positive IP detected in: MCF-7 cells Positive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information MLN64 (also known as STARD3) is an integral membrane protein anchored in late endosomes. MLN64 has a StAR-related lipid-transfer (START) domain to bind cholesterol, mediating intracellular cholesterol transfer. MLN64 is widely expressed in multiple tissues including liver, spleen, heart, kidney, lung, and the brain. Higher expression of MLN64 has been found in several malignancies. MLN64 can be detected as 33 kDa truncated fragment (PMID:9237999, PMID:15718238). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14061 Product name: Recombinant human MLN64,STARD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 170-445 aa of BC008747 Sequence: DFKVLPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSPPESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHGKTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNVRRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIHQSLAATMFEFAFHLRQRISELGARA Predict reactive species Full Name: StAR-related lipid transfer (START) domain containing 3 Calculated Molecular Weight: 445 aa, 51 kDa Observed Molecular Weight: 33-53 kDa GenBank Accession Number: BC008747 Gene Symbol: MLN64/STARD3 Gene ID (NCBI): 10948 RRID: AB_10643978 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q14849 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.