Iright
BRAND / VENDOR: Proteintech

Proteintech, 20299-1-AP, SLC6A8 Polyclonal antibody

CATALOG NUMBER: 20299-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC6A8 (20299-1-AP) by Proteintech is a Polyclonal antibody targeting SLC6A8 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 20299-1-AP targets SLC6A8 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse heart tissue, HUVEC cells, mouse kidney tissue, rat heart tissue, rat kidney tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:300-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information SLC6A8, also known as the sodium- and chloride-dependent creatine transporter 1 (CT1), plays a critical role in transporting creatine, a crucial molecule for energy metabolism, into cells. SLC6A8 belongs to the solute carrier family 6 (SLC6), responsible for transporting diverse molecules across cell membranes. SLC6A8 expression is highest in muscle, kidney, and other tissues with high energy demands. Mutations in SLC6A8 cause creatine transporter deficiency, an X-linked mental retardation disorder (PMID: 17465020). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, bovine Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14110 Product name: Recombinant human SLC6A8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 541-635 aa of BC012355 Sequence: YYEPLVYNNTYVYPWWGEAMGWAFALSSMLCVPLHLLGCLLRAKGTMAERWQHLTQPIWGLHHLEYRAQDADVRGLTTLTPVSESSKVVVVESVM Predict reactive species Full Name: solute carrier family 6 (neurotransmitter transporter, creatine), member 8 Calculated Molecular Weight: 635 aa, 71 kDa Observed Molecular Weight: 65-70 kDa GenBank Accession Number: BC012355 Gene Symbol: SLC6A8 Gene ID (NCBI): 6535 RRID: AB_2878665 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48029 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924