Iright
BRAND / VENDOR: Proteintech

Proteintech, 20302-1-AP, SLC13A4 Polyclonal antibody

CATALOG NUMBER: 20302-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The SLC13A4 (20302-1-AP) by Proteintech is a Polyclonal antibody targeting SLC13A4 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 20302-1-AP targets SLC13A4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells Positive IF/ICC detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information SLC13A4 (also known as SUT-1 or NaS2) belongs to the family of Na+-coupled anion transporters and mediates sulfate reabsorption in the high endothelial venules (HEV). Sulfate is an obligate nutrient for fetal development. Highly expressed in placenta, SLC13A4 has been proposed to play important physiological roles in maintaining high maternal serum sulfate levels during pregnancy and mediating sulfate supply to the fetus. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14116 Product name: Recombinant human SLC13A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 123-285 aa of BC030689 Sequence: LLLCFMCCTTLLSMWLSNTSTTAMVMPIVEAVLQELVSAEDEQLVAGNSNTEEAEPISLDVKNSQPSLELIFVNEESNADLTTLMHNENLNGVPSITNPIKTANQHQGKKQHPSQEKPQVLTRSPRKQKLNRKYRSHHDQMICKCLSLSISYSATIGGLTTII Predict reactive species Full Name: solute carrier family 13 (sodium/sulfate symporters), member 4 Calculated Molecular Weight: 626 aa, 69 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC030689 Gene Symbol: SLC13A4 Gene ID (NCBI): 26266 RRID: AB_10793722 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9UKG4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924