Proteintech, 20306-1-AP, GPR65 Polyclonal antibody

Size: 20ul / 150ul The GPR65 (20306-1-AP) by Proteintech is a Polyclonal antibody targeting GPR65 in IHC, ELISA applications with reactivity to human samples 20306-1-AP targets GPR65 in IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: mouse spleen tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GPR65 (G protein-coupled receptor 65) was defined originally as T-cell death-associated gene 8 (TDAG8), functions as a proton-sensing receptor, and is also sensitive to psychosine (PMID: 35343079). GPR65 promotes adaptation to an acidic environment to enhance cell survival and proliferation, thereby promoting tumor development (PMID: 36852075). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14139 Product name: Recombinant human GPR65 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 238-337 aa of BC035633 Sequence: CFTPFHVMLLIRCILEHAVNFEDHSNSGKRTYTMYRITVALTSLNCVADPILYCFVTETGRYDMWNILKFCTGRCNTSQRQRKRILSVSTKDTMELEVLE Predict reactive species Full Name: G protein-coupled receptor 65 Calculated Molecular Weight: 337 aa, 39 kDa GenBank Accession Number: BC035633 Gene Symbol: GPR65 Gene ID (NCBI): 8477 RRID: AB_2878668 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8IYL9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.