Proteintech, 20311-1-AP, Tetranectin Polyclonal antibody

Size: 20ul / 150ul The Tetranectin (20311-1-AP) by Proteintech is a Polyclonal antibody targeting Tetranectin in WB, IF/ICC, IP, ELISA applications with reactivity to human samples 20311-1-AP targets Tetranectin in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human plasma tissue Positive IP detected in: human plasma tissue Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information C-Type Lectin Domain Family 3 Member B (CLEC3B) is a transmembrane Ca2+-binding protein, locating in cell plasma, extracellular matrix and exosomes. Downregulation of CLEC3B has been reported in various diseases. It was demonstrated in CLEC3B-deficient mice that the absence of CLEC3B impeded the mineralization process in osteogenesis. (PMID: 31477130) Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14147 Product name: Recombinant human CLEC3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 78-202 aa of BC011024 Sequence: HMKCFLAFTQTKTFHEASEDCISRGGTLSTPQTGSENDALYEYLRQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTENCAVLSGAANGKWFDKRCRDQLPYICQFGIV Predict reactive species Full Name: C-type lectin domain family 3, member B Calculated Molecular Weight: 202 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC011024 Gene Symbol: CLEC3B Gene ID (NCBI): 7123 RRID: AB_2878670 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05452 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.