Iright
BRAND / VENDOR: Proteintech

Proteintech, 20313-1-AP, GBE1 Polyclonal antibody

CATALOG NUMBER: 20313-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GBE1 (20313-1-AP) by Proteintech is a Polyclonal antibody targeting GBE1 in WB, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 20313-1-AP targets GBE1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: L02 cells, human skeletal muscle tissue, mouse liver tissue, rat liver tissue Positive IP detected in: L02 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information GBE1 (glucan (1,4-alpha-), branching enzyme 1) is essential for the globular and branched structure of glycogen, increasing solubility by creating a hydrophilic surface and reducing intracellular osmotic pressure. It may serve as a potential therapeutic target for treating LUAD(PMID: 31221150). The full sequence can be further processed into a mature form of 75 kDa. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14154 Product name: Recombinant human GBE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-302 aa of BC012098 Sequence: MAAPMTPAARPEDYEAALNAALADVPELARLLEIDPYLKPYAVDFQRRYKQFSQILKNIGENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVPHGSKLKVVITSKSGEILYRISPWAKYVVREGDNVNYDWIHWDPEHSYEFKHSRPKKPRSLRIYESHVGISSHEGKVASYKHFTCNVLPRIKGLGYNCIQLMAIMEHAYYASFGYQITSFFAASSRYGSPEELQELVDTAHSMGIIVLLDVVHSHASKNSADGLNM Predict reactive species Full Name: glucan (1,4-alpha-), branching enzyme 1 Calculated Molecular Weight: 702 aa, 80 kDa Observed Molecular Weight: 72 kDa GenBank Accession Number: BC012098 Gene Symbol: GBE1 Gene ID (NCBI): 2632 RRID: AB_10697658 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q04446 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924