Proteintech, 20319-1-AP, TSPAN8 Polyclonal antibody

Size: 20ul / 150ul The TSPAN8 (20319-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN8 in WB, IHC, ELISA applications with reactivity to human, rat samples 20319-1-AP targets TSPAN8 in WB, IHC, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HepG2 cells, PC-12 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Background Information TSPAN8 is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Tetraspanins have been involved in diverse processes such as cell activation and proliferation, adhesion and motility, differentiation, and cancer. TSPAN8 and CD151 coordinately promote metastasis, where Tspan8 overrides the adhesive features of CD151 by recruiting integrins out of adhesion into motility promoting complexes (PMID: 23683890). TSPAN8 contributes to molecular pathways of exosome-induced endothelial cell activation (PMID: 20124479). Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14173 Product name: Recombinant human TSPAN8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 97-217 aa of BC005246 Sequence: LLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGIAFGLA Predict reactive species Full Name: tetraspanin 8 Calculated Molecular Weight: 237 aa, 26 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC005246 Gene Symbol: TSPAN8 Gene ID (NCBI): 7103 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P19075 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.