Iright
BRAND / VENDOR: Proteintech

Proteintech, 20320-1-AP, TSPAN32 Polyclonal antibody

CATALOG NUMBER: 20320-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • ddddd

    99 xxxxxx

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The TSPAN32 (20320-1-AP) by Proteintech is a Polyclonal antibody targeting TSPAN32 in WB, ELISA applications with reactivity to human, mouse samples 20320-1-AP targets TSPAN32 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse spleen tissue Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14174 Product name: Recombinant human TSPAN32 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-202 aa of BC016693 Sequence: LAFCAQVQVVFWRLHSPTQVEDAMLDTYDLVYEQAMKGTSHVRRQELAAIQDVFLCCGKKSPFSRLGSTEADLCQGEEAAREDCLQGIRSFLRTHQQVASSLT Predict reactive species Full Name: tetraspanin 32 Calculated Molecular Weight: 320 aa, 35 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC016693 Gene Symbol: TSPAN32 Gene ID (NCBI): 10077 RRID: AB_2878672 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96QS1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924