Product Description
Size: 20ul / 150ul
The MPDU1 (20321-1-AP) by Proteintech is a Polyclonal antibody targeting MPDU1 in WB, ELISA applications with reactivity to human, mouse, rat samples
20321-1-AP targets MPDU1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: human placenta tissue, human testis tissue, mouse testis tissue, rat testis tissue
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag14178 Product name: Recombinant human MPDU1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-84 aa of BC001898 Sequence: MAAEADGPLKRLLVPILLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQVFKILGAKSAEGLSLQSVMLELV Predict reactive species
Full Name: mannose-P-dolichol utilization defect 1
Calculated Molecular Weight: 247 aa, 27 kDa
Observed Molecular Weight: 20 kDa
GenBank Accession Number: BC001898
Gene Symbol: MPDU1
Gene ID (NCBI): 9526
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O75352
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924