Proteintech, 20333-1-AP, AQP1 Polyclonal antibody

Size: 20ul / 150ul The AQP1 (20333-1-AP) by Proteintech is a Polyclonal antibody targeting AQP1 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat samples 20333-1-AP targets AQP1 in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse skeletal muscle tissue, human heart tissue, rat skeletal muscle, mouse kidney, rat kidney Positive IP detected in: mouse kidney tissue, mouse skeletal muscle tissue Positive IHC detected in: mouse kidney tissue, human breast cancer tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human breast cancer tissue, mouse kidney tissue Positive IF-Fro detected in: mouse breast cancer Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:3000-1:12000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800 Background Information AQP1 is a member of aquaporins (AQPs) that are small membrane-spanning proteins facilitating water transport. AQP1 is expressed in most tissues in the mammalian body. Alterations of AQP1 expression have been linked to variety of diseases, including cancer. The predicted molecular weight of AQP1 is around 28 kDa, while highly glycosylated form can also be observed around 35-50 kDa. (PMID:20965731,16508653, 1530176). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, canine, bovine, goat, horse, cat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14093 Product name: Recombinant human AQP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 220-269 aa of BC022486 Sequence: GALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK Predict reactive species Full Name: aquaporin 1 (Colton blood group) Calculated Molecular Weight: 269 aa, 29 kDa Observed Molecular Weight: 25-28 kDa, 35-50 kDa GenBank Accession Number: BC022486 Gene Symbol: AQP1 Gene ID (NCBI): 358 RRID: AB_10666159 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P29972 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.