Iright
BRAND / VENDOR: Proteintech

Proteintech, 20335-1-AP, P2RY13 Polyclonal antibody

CATALOG NUMBER: 20335-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The P2RY13 (20335-1-AP) by Proteintech is a Polyclonal antibody targeting P2RY13 in WB, IHC, ELISA applications with reactivity to human samples 20335-1-AP targets P2RY13 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information P2RY13 (also named GPR86 or GPR94) is a G protein-coupled receptor (GPCR), which is involved in the pathogenesis of inflammation and immune disorders (PMID: 35982893). Several studies have reported that P2RY13 is a key regulator of cholesterol transport and hepatic HDL endocytosis and is involved in bone formation, remodeling, cell survival, and neuroprotection (PMID: 38045624). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14108 Product name: Recombinant human P2RY13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 253-333 aa of BC041116 Sequence: ARVPYTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLCKKFTEKLPCMQGRKTTASSQENHSSQTDNITLG Predict reactive species Full Name: purinergic receptor P2Y, G-protein coupled, 13 Calculated Molecular Weight: 354 aa, 41 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC041116 Gene Symbol: P2RY13 Gene ID (NCBI): 53829 RRID: AB_2878674 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BPV8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924