Proteintech, 20337-1-AP, TADA1L Polyclonal antibody

Size: 20ul / 150ul The TADA1L (20337-1-AP) by Proteintech is a Polyclonal antibody targeting TADA1L in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 20337-1-AP targets TADA1L in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, NIH/3T3 cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:200-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information The function of TADA1L has not been widely studied, and is yet to be fully elucidated. It probably involved in transcriptional regulation.The MW of this protein is 37 kDa, and Catalog#20337-1-AP specially recognises the 37 kDa protein. Specification Tested Reactivity: human, mouse Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14118 Product name: Recombinant human TADA1L protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-335 aa of BC015401 Sequence: MATFVSELEAAKKNLSEALGDNVKQYWANLKLWFKQKISKEEFDLEAHRLLTQDNVHSHNDFLLAILTRCQILVSTPDGAGSLPWPGGSAAKPGKPKGKKKLSSVRQKFDHRFQPQNPLSGAQQFVAKDPQDDDDLKLCSHTMMLPTRGQLEGRMIVTAYEHGLDNVTEEAVSAVVYAVENHLKDILTSVVSRRKAYRLRDGHFKYAFGSNVTPQPYLKNSVVAYNNLIESPPAFTAPCAGQNPASHPPPDDAEQQAALLLACSGDTLPASLPPVNMYDLFEALQVHREVIPTHTVYALNIERIITKLWHPNHEELQQDKVHRQRLAAKEGLLLC Predict reactive species Full Name: transcriptional adaptor 1 (HFI1 homolog, yeast)-like Calculated Molecular Weight: 335 aa, 37 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC015401 Gene Symbol: TADA1L Gene ID (NCBI): 117143 RRID: AB_2878675 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96BN2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.