Iright
BRAND / VENDOR: Proteintech

Proteintech, 20393-1-AP, CCDC72 Polyclonal antibody

CATALOG NUMBER: 20393-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The CCDC72 (20393-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC72 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 20393-1-AP targets CCDC72 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HEK-293 cells, MCF-7 cells Positive IP detected in: A549 cells Positive IHC detected in: human skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200 Background Information CCDC72, also named as TMA7, is a novel modulator for hair follicle development. CCDC72 has the promoter activity and regulation of gene expression. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag13792 Product name: Recombinant human CCDC72 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-64 aa of BC001102 Sequence: MSGREGGKKKPLKQPKKQAKEMDEEDKAFKQKQKEEQKKLEELKAKAAGKGPLATGGIKKSGKK Predict reactive species Full Name: coiled-coil domain containing 72 Calculated Molecular Weight: 64 kDa, 7 kDa Observed Molecular Weight: 7 kDa GenBank Accession Number: BC001102 Gene Symbol: CCDC72 Gene ID (NCBI): 51372 RRID: AB_10667404 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2S6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924