Iright
BRAND / VENDOR: Proteintech

Proteintech, 20410-1-AP, ACN9 Polyclonal antibody

CATALOG NUMBER: 20410-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The ACN9 (20410-1-AP) by Proteintech is a Polyclonal antibody targeting ACN9 in WB, ELISA applications with reactivity to human samples 20410-1-AP targets ACN9 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14242 Product name: Recombinant human ACN9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-125 aa of BC022858 Sequence: KSLGDQYVKDEFRRHKTVGSDEAQRFLQEWEVYATALLQQANENRQNSTGKACFGTFLPEEKLNDFRDEQIGQLQELMQEATKPNRQFSISESMKPKF Predict reactive species Full Name: ACN9 homolog (S. cerevisiae) Calculated Molecular Weight: 125 aa, 15 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC022858 Gene Symbol: ACN9 Gene ID (NCBI): 57001 RRID: AB_3085604 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NRP4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924