Proteintech, 20430-1-AP, TMEM39A Polyclonal antibody

Size: 20ul / 150ul The TMEM39A (20430-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM39A in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 20430-1-AP targets TMEM39A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-87 MG cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Transmembrane protein 39A (TMEM39A, also called SUSR2) encoding an ER-localized transmembrane protein, is a susceptibility locus for multiple autoimmune diseases (PMID: 31806350). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14263 Product name: Recombinant human TMEM39A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 191-297 aa of BC021277 Sequence: YPFGVYVPLCCFHQDSRAHLLLTDYNYVVQHEAVEESASTVGGLAKSKDFLSLLLESLKEQFNNATPIPTHSCPLSPDLIRNEVECLKADFNHRIKEVLFNSLFSAY Predict reactive species Full Name: transmembrane protein 39A Calculated Molecular Weight: 488 aa, 56 kDa Observed Molecular Weight: 48-56 kDa GenBank Accession Number: BC021277 Gene Symbol: TMEM39A Gene ID (NCBI): 55254 RRID: AB_3085605 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NV64 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.