Iright
BRAND / VENDOR: Proteintech

Proteintech, 20436-1-AP, GLUT2 Polyclonal antibody

CATALOG NUMBER: 20436-1-AP
Precio habitual$0.99
/
Los gastos de envío se calculan en la pantalla de pagos.
  • In stock, ready to ship

  • Pedido pendiente, envío pronto

Este sitio está protegido por hCaptcha y se aplican la Política de privacidad de hCaptcha y los Términos del servicio.

Product Description
Size: 20ul / 150ul The GLUT2 (20436-1-AP) by Proteintech is a Polyclonal antibody targeting GLUT2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 20436-1-AP targets GLUT2 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Caco-2 cells, mouse kidney tissue, HEK 293 cells, HepG2 cells, NIH/3T3 cells, mouse liver tissue, rat liver tissue Positive IP detected in: mouse kidney tissue Positive IHC detected in: mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Glucose transporter 2 (GLUT2), also known as solute carrier family 2, facilitated glucose transporter member 2 (SLC2A2), is a transporter protein regulating glucose transport across cell membranes in an insulin-independent manner.What is the molecular weight of GLUT2? Is GLUT2 post-translationally modified?GLUT2 can be N-glycosylated. The molecular weight of mature glycosylated GLUT2 transporter is between 55 and 65 kDa, but a minor 38-kDa form is often detected in hepatocytes that may represent a non-glycosylated or proteolytic product (PMID: 12101013).What is the subcellular localization of GLUT2?Glucose transporters, including GLUT2, are multiple-pass integral membrane proteins. GLUT2 is present at the plasma membrane but has also been reported to be present at intracellular membranes, including the endoplasmic reticulum (PMID: 12101013).What molecules can be transported by GLUT2?Although the main substrate of GLUT2 transport is glucose, it can also transport galactose, mannose, and fructose.What is the tissue expression pattern of GLUT2?GLUT2 is expressed in many cell types. High expression of GLUT2 is observed in hepatocytes, where GLUT2 mediates glucose uptake and release regulating glucose levels in blood, in intestinal cells, where it regulates glucose transport at the basolateral membrane and to a lesser extent from the apical membrane, and in the kidney proximal tubule, where it is involved in glucose reabsorption and is present at the basolateral membrane. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, sheep, lasiopodomys brandtii Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14204 Product name: Recombinant human SLC2A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 69-128 aa of BC060041 Sequence: SPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSYR Predict reactive species Full Name: solute carrier family 2 (facilitated glucose transporter), member 2 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 60-70 kDa, 38-45 kDa GenBank Accession Number: BC060041 Gene Symbol: GLUT2 Gene ID (NCBI): 6514 RRID: AB_2750600 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P11168 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924