Proteintech, 20441-1-AP, YIPF2 Polyclonal antibody

Size: 20ul / 150ul The YIPF2 (20441-1-AP) by Proteintech is a Polyclonal antibody targeting YIPF2 in WB, IP, ELISA applications with reactivity to human samples 20441-1-AP targets YIPF2 in WB, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Positive IP detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information YIPF2 is a member of YIP family whose name refers to the Ypt (yeast RAB GTPase)-interacting protein predicted to have five transmembrane segments with an N-terminal exposed to the cytoplasm and a short C-terminal exposed to the lumen of the secretory pathway. YIPF2 has been reported to mainly locate in the trans-Golgi network (TGN) co-localized with virous RAB proteins, suggesting that it is potentially involved in vesicle transport (PMID: 31189879). YIPF2 can serve as the GDF (GDI-displacement factor) of RAB5/RAB22A and intracellular binder of CD147 in HCC cells (PMID: 311898799). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14238 Product name: Recombinant human YIPF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-86 aa of BC000056 Sequence: MASADELTFHEFEEATNLLADTPDAATTSRSDQLTPQGHVAVAVGSGGSYGAEDEVEEESDKAALLQEQQQQQQPGFWTFSYYQSF Predict reactive species Full Name: Yip1 domain family, member 2 Calculated Molecular Weight: 316 aa, 35 kDa Observed Molecular Weight: 35~40 kDa GenBank Accession Number: BC000056 Gene Symbol: YIPF2 Gene ID (NCBI): 78992 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BWQ6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.