Proteintech, 20442-1-AP, EDG2/LPA1 Polyclonal antibody

Size: 20ul / 150ul The EDG2/LPA1 (20442-1-AP) by Proteintech is a Polyclonal antibody targeting EDG2/LPA1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples 20442-1-AP targets EDG2/LPA1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, A375 cells, HeLa cells, mouse brain tissue, multi-cells/tissue, A549 cells, A2780 cells, NIH3T3 cells Positive IHC detected in: human brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: Jurkat cells Recommended dilution Western Blot (WB): WB : 1:300-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information EDG2 (also known as LPA1) is a G-protein coupled receptor for lysophosphatidic acid (LPA), a potent motility inducing factor, which is a major component of serum (PMID: 19415462). EDG2 is widely expressed in normal tissue during growth and development. In the context of cancer, several studies have suggested that EDG2 expression in tumors is often similar to that shown in normal tissue (PMID: 17496233). Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag14253 Product name: Recombinant human LPAR1,EDG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 305-364 aa of BC030615 Sequence: AMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSNDHSVV Predict reactive species Full Name: lysophosphatidic acid receptor 1 Calculated Molecular Weight: 364 aa, 41 kDa Observed Molecular Weight: 41-50 kDa GenBank Accession Number: BC030615 Gene Symbol: EDG2 Gene ID (NCBI): 1902 RRID: AB_11183048 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q92633 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.